RetrogeneDB ID: | retro_cfam_308 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 1:44574691..44574926(-) | ||
| Located in intron of: | ENSCAFG00000000570 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SSBP1 | ||
| Ensembl ID: | ENSCAFG00000003885 | ||
| Aliases: | None | ||
| Description: | Canis lupus familiaris single-stranded DNA binding protein 1 (SSBP1), nuclear gene encoding mitochondrial protein, mRNA. [Source:RefSeq mRNA;Acc:NM_001252279] |
| Percent Identity: | 63.75 % |
| Parental protein coverage: | 53.38 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | ESETYQMGD-VSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYVEGKVDYGEYTDKNNVRRQATTIIADNI |
| E.E.YQ..D..S.KT.WH..........DVAYQYV.KGS.IYVEGK.DY.EYTDKNNVRRQAT.IIA.N. | |
| Retrocopy | EGEMYQTSD>IS*KTIWHKYQCSEQA-SDVAYQYVNKGSQIYVEGKIDYAEYTDKNNVRRQATRIIASNT |
| Parental | IFLSDQTKEK |
| .FLSD.TK.. | |
| Retrocopy | VFLSD*TKTR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 7 .94 RPM |
| SRP017611_brain | 0 .00 RPM | 9 .21 RPM |
| SRP017611_kidney | 0 .00 RPM | 10 .30 RPM |
| SRP017611_liver | 0 .00 RPM | 3 .12 RPM |