RetrogeneDB ID: | retro_cjac_1824 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 2:94582778..94582997(+) | ||
Located in intron of: | ENSCJAG00000016406 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | HSBP1 | ||
Ensembl ID: | ENSCJAG00000000641 | ||
Aliases: | None | ||
Description: | heat shock factor binding protein 1 [Source:HGNC Symbol;Acc:5203] |
Percent Identity: | 70.27 % |
Parental protein coverage: | 94.74 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | MAETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADL--MTQAGVEELEGEN |
.AE.DPK.VQDLT..VQTLL..M.DKFQTMSDQIIG.IDD....I..LEKNI.DL...T..GVEELEGEN | |
Retrocopy | VAESDPKIVQDLTLMVQTLL*HM*DKFQTMSDQIIGKIDDTNTCI-NLEKNIKDLPYNTDWGVEELEGEN |
Parental | KIPA |
.IPA | |
Retrocopy | RIPA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .27 RPM | 21 .26 RPM |
SRP051959_heart | 0 .09 RPM | 25 .73 RPM |
SRP051959_kidney | 0 .29 RPM | 68 .07 RPM |
SRP051959_liver | 0 .06 RPM | 58 .12 RPM |
SRP051959_lung | 0 .49 RPM | 25 .59 RPM |
SRP051959_lymph_node | 0 .07 RPM | 22 .69 RPM |
SRP051959_skeletal_muscle | 0 .15 RPM | 29 .07 RPM |
SRP051959_spleen | 0 .27 RPM | 36 .37 RPM |