RetrogeneDB ID: | retro_lcha_96 | ||
Retrocopylocation | Organism: | Coelacanth (Latimeria chalumnae) | |
Coordinates: | JH127940.1:538030..538183(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | HSBP1 | ||
Ensembl ID: | ENSLACG00000022519 | ||
Aliases: | None | ||
Description: | heat shock factor binding protein 1 [Source:HGNC Symbol;Acc:5203] |
Percent Identity: | 55.77 % |
Parental protein coverage: | 72.22 % |
Number of stop codons detected: | 4 |
Number of frameshifts detected | 0 |
Parental | MSETDPKTVQDLTAVVQTLLQQMQDKFQTMSDQIIGRIDEMSTRIDDLEKNI |
MS..DPKT.QD.TAV..T.LQQMQ.KF.T.SDQI.G......T....L.KN. | |
Retrocopy | MSAADPKTAQDPTAVI*T-LQQMQHKF*TTSDQIMGWTNG*DTHPY*LDKNV |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
DRP000627_gill | 0 .00 RPM | 15 .22 RPM |
DRP000627_kidney | 0 .00 RPM | 17 .77 RPM |
DRP000627_pectoral_fin | 0 .04 RPM | 13 .54 RPM |
DRP000627_pelvic_fin | 0 .00 RPM | 18 .30 RPM |
DRP000627_pharynx | 0 .00 RPM | 22 .34 RPM |
DRP000627_tail_muscle | 0 .00 RPM | 15 .72 RPM |