RetrogeneDB ID: | retro_ptro_2288 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 5:112828567..112828729(-) | ||
Located in intron of: | ENSPTRG00000017133 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | HSBP1 | ||
Ensembl ID: | ENSPTRG00000008401 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 65.45 % |
Parental protein coverage: | 72.37 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MAETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADL |
.AETDPK.VQDLT..V...LQ....KFQTMSDQ.IG.IDDM...I.DLEKN..DL | |
Retrocopy | VAETDPKIVQDLTLMVEMFLQHV*NKFQTMSDQTIGKIDDMNTLI-DLEKNVKDL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 93 .66 RPM |
SRP007412_cerebellum | 0 .00 RPM | 48 .07 RPM |
SRP007412_heart | 0 .03 RPM | 45 .23 RPM |
SRP007412_kidney | 0 .03 RPM | 115 .25 RPM |
SRP007412_liver | 0 .00 RPM | 49 .17 RPM |
SRP007412_testis | 0 .00 RPM | 193 .69 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_3367 |