RetrogeneDB ID: | retro_ttru_849 | ||
Retrocopylocation | Organism: | Dolphin (Tursiops truncatus) | |
Coordinates: | GeneScaffold_364:98378..98605(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | HSBP1 | ||
Ensembl ID: | ENSTTRG00000008666 | ||
Aliases: | None | ||
Description: | heat shock factor binding protein 1 [Source:HGNC Symbol;Acc:5203] |
Percent Identity: | 71.79 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | MAETEPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRTLDDMSSRIDDLEKNIADLMTQAGVEELDGENK |
.AET.PKTVQDLTSVVQTLLQQMQ.K.QT.S.QII.R...DMS.R.DD.EKNIA.L...AG.EELDGE.K | |
Retrocopy | VAETDPKTVQDLTSVVQTLLQQMQGKWQTKSNQIIAR-IEDMSGRMDDPEKNIAALVIRAGGEELDGEDK |
Parental | I-PATQKS |
..PA.QKS | |
Retrocopy | T<PAAQKS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |