RetrogeneDB ID: | retro_nleu_963 | ||
Retrocopy location | Organism: | Gibbon (Nomascus leucogenys) | |
| Coordinates: | GL397277.1:11094227..11094389(-) | ||
| Located in intron of: | ENSNLEG00000011488 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | HSBP1 | ||
| Ensembl ID: | ENSNLEG00000026776 | ||
| Aliases: | None | ||
| Description: | heat shock factor binding protein 1 [Source:HGNC Symbol;Acc:5203] |
| Percent Identity: | 56.36 % |
| Parental protein coverage: | 72.37 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MAETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADL |
| .AET.PK..QDLT......LQ....KFQTMSDQIIG..DDM.....D.EKN..DL | |
| Retrocopy | VAETGPKIMQDLTLMMEMVLQHV*NKFQTMSDQIIGKTDDMNT-LTDHEKNVEDL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |