RetrogeneDB ID: | retro_ptro_2075 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 4:112878406..112878631(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | HSBP1 | ||
Ensembl ID: | ENSPTRG00000008401 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 81.33 % |
Parental protein coverage: | 98.68 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MAETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELESENKI |
.AETDPK..Q.LTSVVQ.LLQQ.Q.KFQTMSDQI.GR.DDMSS..DDLEKNIADL.TQAGVEELES.NKI | |
Retrocopy | IAETDPKNEQELTSVVQKLLQQIQNKFQTMSDQITGRTDDMSSCTDDLEKNIADLVTQAGVEELESKNKI |
Parental | PATQK |
PATQ. | |
Retrocopy | PATQE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 93 .66 RPM |
SRP007412_cerebellum | 0 .00 RPM | 48 .07 RPM |
SRP007412_heart | 0 .00 RPM | 45 .23 RPM |
SRP007412_kidney | 2 .14 RPM | 115 .25 RPM |
SRP007412_liver | 0 .13 RPM | 49 .17 RPM |
SRP007412_testis | 0 .11 RPM | 193 .69 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_3076 |