RetrogeneDB ID: | retro_cfam_772 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 17:20141607..20141835(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | HSBP1 | ||
| Ensembl ID: | ENSCAFG00000019973 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 69.23 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | MAETDPKT-VQDLTSVVQTLLQQMQDKFQTMSDQIIG-RIDDMSSRIDDLEKNIADLMTQAGVEELEGEN |
| M.ETDP.T...DLT.VV.TLLQQMQDK..TMSD.I.G.R.D.M.S..DDLEKNIADLMTQAG.EE...E. | |
| Retrocopy | MVETDPST<PKDLTLVV*TLLQQMQDKCRTMSD*IVG>RTDGMRSPTDDLEKNIADLMTQAGAEEPADED |
| Parental | KIPATPKS |
| KI.AT.KS | |
| Retrocopy | KISATLKS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 82 .61 RPM |
| SRP017611_brain | 0 .00 RPM | 34 .14 RPM |
| SRP017611_kidney | 0 .00 RPM | 469 .72 RPM |
| SRP017611_liver | 0 .00 RPM | 25 .96 RPM |