RetrogeneDB ID: | retro_ecab_580 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 21:35689483..35689703(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | HSBP1 | ||
| Ensembl ID: | ENSECAG00000026920 | ||
| Aliases: | None | ||
| Description: | heat shock factor binding protein 1 [Source:HGNC Symbol;Acc:5203] |
| Percent Identity: | 78.67 % |
| Parental protein coverage: | 96.1 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | AETDP-KTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRTLDDMSSRIDDLEKNIADLMTQAGVEELEGENK |
| A.T.P.KTVQDL.SV.QTLLQQMQDKFQ.MSDQ.IGR..DDMSS..DDLE.NIADL.T.AGVEELEGENK | |
| Retrocopy | AKTGP>KTVQDLPSVMQTLLQQMQDKFQSMSDQAIGRP-DDMSSCTDDLERNIADLVT*AGVEELEGENK |
| Parental | ILATQ |
| I.AT. | |
| Retrocopy | IPATK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 7 .44 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 24 .88 RPM |
| SRP021940_embryo | 0 .00 RPM | 26 .03 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 24 .68 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 16 .36 RPM |
| SRP021940_testis | 0 .00 RPM | 74 .49 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Canis familiaris | retro_cfam_1712 |