RetrogeneDB ID: | retro_ecab_580 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
Coordinates: | 21:35689483..35689703(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | HSBP1 | ||
Ensembl ID: | ENSECAG00000026920 | ||
Aliases: | None | ||
Description: | heat shock factor binding protein 1 [Source:HGNC Symbol;Acc:5203] |
Percent Identity: | 78.67 % |
Parental protein coverage: | 96.1 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | AETDP-KTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRTLDDMSSRIDDLEKNIADLMTQAGVEELEGENK |
A.T.P.KTVQDL.SV.QTLLQQMQDKFQ.MSDQ.IGR..DDMSS..DDLE.NIADL.T.AGVEELEGENK | |
Retrocopy | AKTGP>KTVQDLPSVMQTLLQQMQDKFQSMSDQAIGRP-DDMSSCTDDLERNIADLVT*AGVEELEGENK |
Parental | ILATQ |
I.AT. | |
Retrocopy | IPATK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP021940_articular_cartilage | 0 .00 RPM | 7 .44 RPM |
SRP021940_cerebellum | 0 .00 RPM | 24 .88 RPM |
SRP021940_embryo | 0 .00 RPM | 26 .03 RPM |
SRP021940_placental_villous | 0 .00 RPM | 24 .68 RPM |
SRP021940_synovial_membrane | 0 .00 RPM | 16 .36 RPM |
SRP021940_testis | 0 .00 RPM | 74 .49 RPM |
Species | RetrogeneDB ID |
---|---|
Canis familiaris | retro_cfam_1712 |