RetrogeneDB ID: | retro_cjac_2725 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 6:51775950..51776276(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PDAP1 | ||
Ensembl ID: | ENSCJAG00000015838 | ||
Aliases: | None | ||
Description: | PDGFA associated protein 1 [Source:HGNC Symbol;Acc:14634] |
Percent Identity: | 50.89 % |
Parental protein coverage: | 60.77 % |
Number of stop codons detected: | 4 |
Number of frameshifts detected | 1 |
Parental | ARQYTSPEEIDAQLQAEKQK-AREEEEQ-KEGGDGAAGDPKKEKKSLDSDDSEDEEDDYQQKRKGVEGLI |
AR...SP.E.DAQLQAEK...AREEE.Q..EGGDGA...PKKEKKSLDSD..ED....YQQK.K.....I | |
Retrocopy | ARKLRSP*EVDAQLQAEKPG<AREEE*QGEEGGDGA--HPKKEKKSLDSDENEDVTNGYQQKCKDMD*VI |
Parental | DIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKER |
.I.N......T..K....DL...KEL.RR.....E......R | |
Retrocopy | NIKNTIQLE*TIRKFKGVDLNRLKELLRRKCTSREDRASQGR |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 17 .37 RPM |
SRP051959_heart | 0 .00 RPM | 21 .82 RPM |
SRP051959_kidney | 0 .00 RPM | 25 .03 RPM |
SRP051959_liver | 0 .00 RPM | 17 .05 RPM |
SRP051959_lung | 0 .00 RPM | 20 .58 RPM |
SRP051959_lymph_node | 0 .00 RPM | 16 .00 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 36 .43 RPM |
SRP051959_spleen | 0 .00 RPM | 16 .51 RPM |
Species | RetrogeneDB ID |
---|---|
Pan troglodytes | retro_ptro_1711 |
Gorilla gorilla | retro_ggor_1776 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000015838 | 2 retrocopies |
retro_cjac_2676, retro_cjac_2725 ,
|
Equus caballus | ENSECAG00000024426 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000009926 | 1 retrocopy | |
Felis catus | ENSFCAG00000015067 | 1 retrocopy | |
Homo sapiens | ENSG00000106244 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000025196 | 5 retrocopies | |
Macaca mulatta | ENSMMUG00000001460 | 2 retrocopies | |
Mus musculus | ENSMUSG00000029623 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000011017 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000010874 | 2 retrocopies | |
Ochotona princeps | ENSOPRG00000013615 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000017375 | 4 retrocopies | |
Pan troglodytes | ENSPTRG00000041711 | 4 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000001679 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000010152 | 5 retrocopies | |
Tursiops truncatus | ENSTTRG00000003004 | 1 retrocopy |