RetrogeneDB ID: | retro_cjac_2676 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 5:141192505..141192899(-) | ||
| Located in intron of: | ENSCJAG00000019421 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PDAP1 | ||
| Ensembl ID: | ENSCJAG00000015838 | ||
| Aliases: | None | ||
| Description: | PDGFA associated protein 1 [Source:HGNC Symbol;Acc:14634] |
| Percent Identity: | 75.74 % |
| Parental protein coverage: | 74.03 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKARE-EEE-QKEGGDGAAGDPKKEKKSLDSDDSEDEED |
| .P.GGRKGG.KGRARQ.TSPEEI..QLQAEKQK....EEE.QKEGGD.AAGDPKKEKKSLDSD.SEDEED | |
| Retrocopy | LPNGGRKGGRKGRARQHTSPEEIYVQLQAEKQKEGR>EEEEQKEGGDRAAGDPKKEKKSLDSDESEDEED |
| Parental | DYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKERYMKMHLAGKTE |
| DYQQK.KG.EGL.DIENPN.VAQT..KVTQLDL.....LSRRE...IEKQ.AK.RY.K.HLAGK.. | |
| Retrocopy | DYQQKCKGAEGLTDIENPNQVAQTSNKVTQLDLE----LSRREGDKIEKQ*AKKRYVKTHLAGKSK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .20 RPM | 17 .37 RPM |
| SRP051959_heart | 0 .18 RPM | 21 .82 RPM |
| SRP051959_kidney | 0 .13 RPM | 25 .03 RPM |
| SRP051959_liver | 0 .06 RPM | 17 .05 RPM |
| SRP051959_lung | 0 .39 RPM | 20 .58 RPM |
| SRP051959_lymph_node | 0 .34 RPM | 16 .00 RPM |
| SRP051959_skeletal_muscle | 0 .11 RPM | 36 .43 RPM |
| SRP051959_spleen | 0 .13 RPM | 16 .51 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000015838 | 2 retrocopies |
retro_cjac_2676 , retro_cjac_2725,
|
| Equus caballus | ENSECAG00000024426 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000009926 | 1 retrocopy | |
| Felis catus | ENSFCAG00000015067 | 1 retrocopy | |
| Homo sapiens | ENSG00000106244 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000025196 | 5 retrocopies | |
| Macaca mulatta | ENSMMUG00000001460 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000029623 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000011017 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000010874 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000013615 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000017375 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000041711 | 4 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000001679 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000010152 | 5 retrocopies | |
| Tursiops truncatus | ENSTTRG00000003004 | 1 retrocopy |