RetrogeneDB ID: | retro_pabe_2659 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 5:85964647..85965084(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PDAP1 | ||
Ensembl ID: | ENSPPYG00000017375 | ||
Aliases: | None | ||
Description: | PDGFA associated protein 1 [Source:HGNC Symbol;Acc:14634] |
Percent Identity: | 92.52 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | EEEE-QKEGGDGAAGDPKKEKKSLDSDESEDEEDDYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGP |
EEE..QKEGGDGAAGDPKKEKKSLDSDESEDEEDDYQQKRKGVEGL.DIENPNRVAQTTKKVTQLDLDGP | |
Retrocopy | EEED<QKEGGDGAAGDPKKEKKSLDSDESEDEEDDYQQKRKGVEGLRDIENPNRVAQTTKKVTQLDLDGP |
Parental | KELSRREREEIEKQKAKERYMKMHLAGKTEQAKADLARLAIIRKQREEAARKKEEERKAKDDATLSGKRM |
.ELSRRE.EEIEKQKAK.RYMKMHLAGK.EQAK.DLA.LAII.KQREEAARKKEEERKAKD.ATLSGKRM | |
Retrocopy | TELSRREGEEIEKQKAKQRYMKMHLAGKAEQAKVDLAQLAIIWKQREEAARKKEEERKAKD*ATLSGKRM |
Parental | QSLSLNK |
QSLSLNK | |
Retrocopy | QSLSLNK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 74 .97 RPM |
SRP007412_cerebellum | 0 .00 RPM | 38 .91 RPM |
SRP007412_heart | 0 .00 RPM | 31 .43 RPM |
SRP007412_kidney | 0 .00 RPM | 72 .53 RPM |
SRP007412_liver | 0 .00 RPM | 39 .20 RPM |
Species | RetrogeneDB ID |
---|---|
Pan troglodytes | retro_ptro_2240 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000015838 | 2 retrocopies | |
Equus caballus | ENSECAG00000024426 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000009926 | 1 retrocopy | |
Felis catus | ENSFCAG00000015067 | 1 retrocopy | |
Homo sapiens | ENSG00000106244 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000025196 | 5 retrocopies | |
Macaca mulatta | ENSMMUG00000001460 | 2 retrocopies | |
Mus musculus | ENSMUSG00000029623 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000011017 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000010874 | 2 retrocopies | |
Ochotona princeps | ENSOPRG00000013615 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000017375 | 4 retrocopies | |
Pan troglodytes | ENSPTRG00000041711 | 4 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000001679 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000010152 | 5 retrocopies | |
Tursiops truncatus | ENSTTRG00000003004 | 1 retrocopy |