RetrogeneDB ID: | retro_pabe_2806 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 5_random:2565419..2565856(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PDAP1 | ||
| Ensembl ID: | ENSPPYG00000017375 | ||
| Aliases: | None | ||
| Description: | PDGFA associated protein 1 [Source:HGNC Symbol;Acc:14634] |
| Percent Identity: | 93.2 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | EEEE-QKEGGDGAAGDPKKEKKSLDSDESEDEEDDYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGP |
| EEE..QKEGGDGAAGDPKKEKKSLDSDESEDEEDDYQQKRKGVEGL.DIENPNRVAQTTKKVTQLDLDGP | |
| Retrocopy | EEED<QKEGGDGAAGDPKKEKKSLDSDESEDEEDDYQQKRKGVEGLRDIENPNRVAQTTKKVTQLDLDGP |
| Parental | KELSRREREEIEKQKAKERYMKMHLAGKTEQAKADLARLAIIRKQREEAARKKEEERKAKDDATLSGKRM |
| .ELSRRE.EEIEKQKAK.RYMKMHLAGK.EQAKADLA.LAII.KQREEAARKKEEERKAKD.ATLSGKRM | |
| Retrocopy | TELSRREGEEIEKQKAKQRYMKMHLAGKAEQAKADLAQLAIIWKQREEAARKKEEERKAKDYATLSGKRM |
| Parental | QSLSLNK |
| QSLSLNK | |
| Retrocopy | QSLSLNK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 74 .97 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 38 .91 RPM |
| SRP007412_heart | 0 .00 RPM | 31 .43 RPM |
| SRP007412_kidney | 0 .00 RPM | 72 .53 RPM |
| SRP007412_liver | 0 .00 RPM | 39 .20 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000015838 | 2 retrocopies | |
| Equus caballus | ENSECAG00000024426 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000009926 | 1 retrocopy | |
| Felis catus | ENSFCAG00000015067 | 1 retrocopy | |
| Homo sapiens | ENSG00000106244 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000025196 | 5 retrocopies | |
| Macaca mulatta | ENSMMUG00000001460 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000029623 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000011017 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000010874 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000013615 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000017375 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000041711 | 4 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000001679 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000010152 | 5 retrocopies | |
| Tursiops truncatus | ENSTTRG00000003004 | 1 retrocopy |