RetrogeneDB ID: | retro_ptro_1711 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 2B:171199011..171199339(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PDAP1 | ||
Ensembl ID: | ENSPTRG00000041711 | ||
Aliases: | None | ||
Description: | PDGFA associated protein 1 [Source:HGNC Symbol;Acc:14634] |
Percent Identity: | 60.71 % |
Parental protein coverage: | 61.33 % |
Number of stop codons detected: | 4 |
Number of frameshifts detected | 1 |
Parental | MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGDPKKEKK-SLDSDESEDEEDD |
MPKGGR.GGHK..AR...SP.E.D.QLQAEKQKA.EEEEQ..G..G..G...K..K..LD..E.E.EE.D | |
Retrocopy | MPKGGRTGGHKSQARK*SSP*EVDTQLQAEKQKAMEEEEQ--GEEGGDGAYPKKGK>NLDL*ENENEEND |
Parental | YQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRRE |
YQQK.KG.EGLI...NP..V..TT.KV.Q.DLD..KEL.RR. | |
Retrocopy | YQQKHKGMEGLINLKNPKQVG*TTRKVKQVDLDRLKELLRRK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 86 .71 RPM |
SRP007412_cerebellum | 0 .00 RPM | 84 .14 RPM |
SRP007412_heart | 0 .00 RPM | 51 .82 RPM |
SRP007412_kidney | 0 .00 RPM | 61 .64 RPM |
SRP007412_liver | 0 .00 RPM | 67 .11 RPM |
SRP007412_testis | 0 .00 RPM | 54 .38 RPM |
Species | RetrogeneDB ID |
---|---|
Gorilla gorilla | retro_ggor_1776 |
Callithrix jacchus | retro_cjac_2725 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000015838 | 2 retrocopies | |
Equus caballus | ENSECAG00000024426 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000009926 | 1 retrocopy | |
Felis catus | ENSFCAG00000015067 | 1 retrocopy | |
Homo sapiens | ENSG00000106244 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000025196 | 5 retrocopies | |
Macaca mulatta | ENSMMUG00000001460 | 2 retrocopies | |
Mus musculus | ENSMUSG00000029623 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000011017 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000010874 | 2 retrocopies | |
Ochotona princeps | ENSOPRG00000013615 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000017375 | 4 retrocopies | |
Pan troglodytes | ENSPTRG00000041711 | 4 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000001679 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000010152 | 5 retrocopies | |
Tursiops truncatus | ENSTTRG00000003004 | 1 retrocopy |