RetrogeneDB ID: | retro_cpor_1377 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
Coordinates: | scaffold_76:7067292..7067514(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPS23 | ||
Ensembl ID: | ENSCPOG00000022705 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 69.74 % |
Parental protein coverage: | 51.75 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | ANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVR-VQLIKNGKK-ITAFVPNDGCLNFIEENDEVLVAGF |
A.P.GGAS.AK.I.LE.VG.E.KQPNS.I.KCVR.VQLIKN.KK.IT.FVP..G.LNFIEEND.VL.A.. | |
Retrocopy | ASPSGGASNAKEIMLEEVGAETKQPNSVISKCVR<VQLIKNSKK>ITVFVPKNGSLNFIEENDKVLGAVC |
Parental | GRKGHA |
G.K.HA | |
Retrocopy | GQKVHA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .12 RPM | 49 .23 RPM |
SRP017611_kidney | 0 .94 RPM | 101 .23 RPM |
SRP017611_liver | 0 .57 RPM | 70 .91 RPM |
SRP040447_lung | 0 .15 RPM | 175 .21 RPM |
SRP040447_skeletal_muscle | 0 .37 RPM | 135 .13 RPM |