RetrogeneDB ID: | retro_dnov_2140 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_5083:22659..22889(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSDNOG00000012633 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 78.21 % |
Parental protein coverage: | 57.04 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | KRIQRGPVRGISIKLQEEERERRDNYVPEVSALDQEIIEVDPDTKEMLKLLDFGSLSNLQVTQPTVGM-N |
K.IQRGP.R.ISIKLQEEE.ERR.NYVP.VS.LDQEI.E..PDTKEMLKLLDF.SLS.LQVTQPTVGM.. | |
Retrocopy | KWIQRGPMRDISIKLQEEEKERRENYVPVVSTLDQEITEIGPDTKEMLKLLDFSSLSTLQVTQPTVGM<D |
Parental | FKTPRGAV |
FKTP.G.. | |
Retrocopy | FKTPCGTI |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 304 .15 RPM |
SRP012922_cerebellum | 0 .00 RPM | 94 .03 RPM |
SRP012922_heart | 0 .00 RPM | 193 .51 RPM |
SRP012922_kidney | 0 .00 RPM | 302 .00 RPM |
SRP012922_liver | 0 .00 RPM | 162 .86 RPM |
SRP012922_lung | 0 .00 RPM | 321 .48 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 272 .26 RPM |
SRP012922_spleen | 0 .00 RPM | 467 .23 RPM |