RetrogeneDB ID: | retro_mdom_342 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 1:228400061..228400301(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSMODG00000002011 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 65. % |
Parental protein coverage: | 57.14 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | HLMKRIQRGPVRGISIKLQEEERERRDNYVPEVSALDQEIIEVDPDTKEMLKLLDFGSLSNLQVTQPTVG |
HLMK.I...PV...S.K.Q.EERER..NYVP.VSALD.EIIEVDPDTK.MLKLLDF..LSNLQ.....V. | |
Retrocopy | HLMKCI*GDPVTDLSSKMQKEERERLYNYVPHVSALDEEIIEVDPDTKRMLKLLDFSNLSNLQLILLAVR |
Parental | MNFKTPRGAV |
.NF.TP..A. | |
Retrocopy | INF*TPKVAI |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 276 .42 RPM |
SRP007412_cerebellum | 0 .00 RPM | 207 .30 RPM |
SRP007412_heart | 0 .00 RPM | 660 .65 RPM |
SRP007412_kidney | 0 .00 RPM | 655 .78 RPM |
SRP007412_liver | 0 .00 RPM | 868 .52 RPM |
SRP007412_testis | 0 .00 RPM | 521 .33 RPM |