RetrogeneDB ID: | retro_dnov_460 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | GeneScaffold_5002:4699..5011(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CDV3 | ||
Ensembl ID: | ENSDNOG00000010208 | ||
Aliases: | None | ||
Description: | CDV3 homolog (mouse) [Source:HGNC Symbol;Acc:26928] |
Percent Identity: | 64.76 % |
Parental protein coverage: | 57.3 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | DEDEWKEFEQKEVDYSGLRVQAMQISSEKEEDDNEKREDPGDNWEEG-GGGGGGVEKSSGPWNKTAVVQA |
DEDEWKEFEQKEVDYS...VQ.MQ...E...D.NEKREDPGDNWEE.........EKSS.P.NKT..VQ. | |
Retrocopy | DEDEWKEFEQKEVDYSSFQVQVMQL-NERKKDENEKREDPGDNWEESRXXXXXXXEKSSDP*NKTVLVQV |
Parental | PPAPVIVTETPEPAMTSGVYRPPGA--RLTTTRKT |
PPAPVIVTE.PE.AMT.GV...PGA.....TTR.T | |
Retrocopy | PPAPVIVTEIPEVAMTTGVNGLPGAYNKENTTRTT |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .19 RPM | 26 .64 RPM |
SRP012922_cerebellum | 0 .00 RPM | 13 .47 RPM |
SRP012922_heart | 0 .00 RPM | 38 .29 RPM |
SRP012922_kidney | 0 .00 RPM | 30 .67 RPM |
SRP012922_liver | 0 .00 RPM | 20 .28 RPM |
SRP012922_lung | 0 .00 RPM | 23 .67 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 48 .46 RPM |
SRP012922_spleen | 0 .00 RPM | 33 .88 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000035556 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000008963 | 5 retrocopies | |
Callithrix jacchus | ENSCJAG00000002998 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000010208 | 5 retrocopies | |
Equus caballus | ENSECAG00000015689 | 2 retrocopies | |
Homo sapiens | ENSG00000091527 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000027821 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000009864 | 1 retrocopy | |
Mus musculus | ENSMUSG00000032803 | 10 retrocopies | |
Nomascus leucogenys | ENSNLEG00000003470 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000012748 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000003600 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000025898 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000015409 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000011637 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000014910 | 5 retrocopies | |
Tarsius syrichta | ENSTSYG00000011401 | 2 retrocopies |