RetrogeneDB ID: | retro_ptro_1805 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 3:99840558..99840990(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CDV3 | ||
| Ensembl ID: | ENSPTRG00000015409 | ||
| Aliases: | None | ||
| Description: | CDV3 homolog (mouse) [Source:HGNC Symbol;Acc:26928] |
| Percent Identity: | 87.59 % |
| Parental protein coverage: | 55.64 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | KRQDPGDNWEEGGGGGGGMEKSSGPWNKTAPVQAPPAPVIVTETPEPAMTSGVY--RPPGARLTTTRKTP |
| KRQDPGDNWEEGGGGG...EKSSGPWNKTA.VQAP.APVIVT.TPE.AMTS.....RPPGARLTTTRKTP | |
| Retrocopy | KRQDPGDNWEEGGGGGD-TEKSSGPWNKTALVQAPLAPVIVTVTPELAMTSXXXXXRPPGARLTTTRKTP |
| Parental | QGPPEIYSDTQFPSLQSTAKHVESRKDKEMEKSFEVVRHKNRGRDEVSKNQALKLQLDNQYAVLENQKSS |
| QGPPEIYS.TQFPSLQSTAKH.ESRKDKEMEKSF.V.RHKNRGRDEVSKNQALKLQLDNQYAVLENQK.S | |
| Retrocopy | QGPPEIYSNTQFPSLQSTAKHIESRKDKEMEKSFQVIRHKNRGRDEVSKNQALKLQLDNQYAVLENQKRS |
| Parental | HSQYN |
| HSQY. | |
| Retrocopy | HSQYS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 50 .69 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 57 .68 RPM |
| SRP007412_heart | 0 .00 RPM | 124 .86 RPM |
| SRP007412_kidney | 0 .00 RPM | 119 .25 RPM |
| SRP007412_liver | 0 .00 RPM | 96 .86 RPM |
| SRP007412_testis | 0 .00 RPM | 209 .40 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2678 |
| Gorilla gorilla | retro_ggor_1869 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000035556 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000008963 | 5 retrocopies | |
| Callithrix jacchus | ENSCJAG00000002998 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000010208 | 5 retrocopies | |
| Equus caballus | ENSECAG00000015689 | 2 retrocopies | |
| Homo sapiens | ENSG00000091527 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000027821 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000009864 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000032803 | 10 retrocopies | |
| Ochotona princeps | ENSOPRG00000003600 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000025898 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000015409 | 1 retrocopy |
retro_ptro_1805 ,
|
| Sus scrofa | ENSSSCG00000011637 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000014910 | 5 retrocopies |