RetrogeneDB ID: | retro_mmus_1266 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 14:43121774..43122218(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSMUSG00000090389 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Cdv3 | ||
| Ensembl ID: | ENSMUSG00000032803 | ||
| Aliases: | Cdv3, 2510010F10Rik, C230084J24Rik, C79446, TPP36 | ||
| Description: | carnitine deficiency-associated gene expressed in ventricle 3 [Source:MGI Symbol;Acc:MGI:2448759] |
| Percent Identity: | 98.65 % |
| Parental protein coverage: | 62.71 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | RSGDGGSAGPAGKAITKDENEWKEFEQREVDYSGLRVQAMQISEKEDDDNEKREDPGDNWEEGGGGSGAE |
| RSGDGGSAGPAGKAITKDENEWKEFEQREVDYSGLRVQAMQISEKEDDDNEKREDPGDNWEEGGGGSGAE | |
| Retrocopy | RSGDGGSAGPAGKAITKDENEWKEFEQREVDYSGLRVQAMQISEKEDDDNEKREDPGDNWEEGGGGSGAE |
| Parental | KSSGPWNKTAPVQAPPAPVTVTETPEPAMPSGVYRPPGARLTTTRKTPQGPPEIYSDTQFPSLQSTAKHV |
| KSSGPWNKTAPVQAPPAPVTVTETPEPAMPSGVYRPPGARLTTTRKTPQGPPEIYSDTQFPSLQSTAKHV | |
| Retrocopy | KSSGPWNKTAPVQAPPAPVTVTETPEPAMPSGVYRPPGARLTTTRKTPQGPPEIYSDTQFPSLQSTAKHV |
| Parental | ESRNRYLK |
| ESR.RYL. | |
| Retrocopy | ESRDRYLQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .07 RPM | 40 .39 RPM |
| SRP007412_cerebellum | 0 .09 RPM | 30 .48 RPM |
| SRP007412_heart | 0 .09 RPM | 46 .13 RPM |
| SRP007412_kidney | 0 .10 RPM | 41 .35 RPM |
| SRP007412_liver | 0 .08 RPM | 51 .23 RPM |
| SRP007412_testis | 0 .46 RPM | 116 .68 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000035556 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000008963 | 5 retrocopies | |
| Callithrix jacchus | ENSCJAG00000002998 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000010208 | 5 retrocopies | |
| Equus caballus | ENSECAG00000015689 | 2 retrocopies | |
| Homo sapiens | ENSG00000091527 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000027821 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000009864 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000032803 | 10 retrocopies |
retro_mmus_1266 , retro_mmus_2405, retro_mmus_2408, retro_mmus_2411, retro_mmus_2412, retro_mmus_2416, retro_mmus_2418, retro_mmus_2422, retro_mmus_2423, retro_mmus_2534,
|
| Ochotona princeps | ENSOPRG00000003600 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000025898 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000015409 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000011637 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000014910 | 5 retrocopies |