RetrogeneDB ID: | retro_itri_1542 | ||
Retrocopy location | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
| Coordinates: | JH393535.1:1657953..1658199(-) | ||
| Located in intron of: | ENSSTOG00000023651 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL34 | ||
| Ensembl ID: | ENSSTOG00000025964 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L34 [Source:HGNC Symbol;Acc:10340] |
| Percent Identity: | 66.67 % |
| Parental protein coverage: | 70.09 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 2 |
| Parental | MVQRLTYRRRLSYNTASNKTRLSRTPGNRI-VYLYTKKVGKAPKSACGVCPGRLRGVRAVRPKVLMRLSK |
| ..Q...Y..RLSY.TASNKTRLS.T.GN...VY.YTKKVG..PKSACG..PG...GV..VR..VLMRLSK | |
| Retrocopy | IIQHFLYP*RLSYYTASNKTRLS*TLGNGV<VYFYTKKVGEEPKSACGMYPG*FQGVHTVRTEVLMRLSK |
| Parental | -TKKHVSRAYGGSM |
| ..K.HVSRAYGGSM | |
| Retrocopy | >CKNHVSRAYGGSM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |