RetrogeneDB ID: | retro_ptro_643 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 11:109849034..109849250(-) | ||
Located in intron of: | ENSPTRG00000004278 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPL34 | ||
Ensembl ID: | ENSPTRG00000016353 | ||
Aliases: | None | ||
Description: | ribosomal protein L34 [Source:HGNC Symbol;Acc:10340] |
Percent Identity: | 68.06 % |
Parental protein coverage: | 61.54 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVRPKVLMRLSKT |
MVQ.L.Y..RL..NTASNK.RLS..P..R.VYL.TKKVGK.PKSACGVCPGRL..V.A..PKVL.R.SK. | |
Retrocopy | MVQHLAYHCRLFCNTASNKIRLSQIPVHRTVYLHTKKVGKTPKSACGVCPGRLQ*VPAMTPKVLKRFSKI |
Parental | KK |
.K | |
Retrocopy | NK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 97 .95 RPM |
SRP007412_cerebellum | 0 .00 RPM | 85 .36 RPM |
SRP007412_heart | 0 .00 RPM | 66 .98 RPM |
SRP007412_kidney | 0 .00 RPM | 223 .00 RPM |
SRP007412_liver | 0 .00 RPM | 113 .88 RPM |
SRP007412_testis | 0 .00 RPM | 50 .79 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_927 |
Gorilla gorilla | retro_ggor_747 |