RetrogeneDB ID: | retro_mmur_417 | ||
Retrocopylocation | Organism: | Mouse Lemur (Microcebus murinus) | |
Coordinates: | GeneScaffold_2914:1001543..1001759(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPL34 | ||
Ensembl ID: | ENSMICG00000002180 | ||
Aliases: | None | ||
Description: | ribosomal protein L34 [Source:HGNC Symbol;Acc:10340] |
Percent Identity: | 68.06 % |
Parental protein coverage: | 61.54 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | KSACGVCPGRLRGVRAVRPKVLMRLSKTKKHVSRAYGGSMCAKCVRDRIKRAFLIEEQKIVVKVLKAQAQ |
..A.G..PGRLRGV.AVRPKV.MRLS.TK.H.SRA.GGS.C...VR.RIKRAFLIEEQK..VK.L..QA. | |
Retrocopy | QTARGMSPGRLRGVHAVRPKVPMRLSETKEHASRA*GGSLCVERVRGRIKRAFLIEEQKVAVKALRTQAE |
Parental | SQ |
S. | |
Retrocopy | SE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |