RetrogeneDB ID: | retro_itri_552 | ||
Retrocopy location | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
| Coordinates: | JH393301.1:612284..612506(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | DNAJC19 | ||
| Ensembl ID: | ENSSTOG00000011508 | ||
| Aliases: | None | ||
| Description: | DnaJ (Hsp40) homolog, subfamily C, member 19 [Source:HGNC Symbol;Acc:30528] |
| Percent Identity: | 65.79 % |
| Parental protein coverage: | 58.91 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | VLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFETKMTKREAALILGVSPTANKAKIRDAHRRIMLLNHP |
| .LQAMKHMEPQVK..FQSLPKSA.SG..YRGGFE.KMTK.EA.LIL...P.....KIRDA...IMLLN.P | |
| Retrocopy | ILQAMKHMEPQVKYKFQSLPKSAVSGSCYRGGFEIKMTKQEATLIL-FKPYSQ*RKIRDA-*QIMLLNCP |
| Parental | DKGPLV |
| ....L. | |
| Retrocopy | KEDLLL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |