RetrogeneDB ID: | retro_mmul_269 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 17:30871429..30871669(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSMMUG00000030714 | |
| Aliases: | None | ||
| Status: | KNOWN_PROTEIN_CODING | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.3201 | ||
| Ensembl ID: | ENSMMUG00000012534 | ||
| Aliases: | None | ||
| Description: | cyclin-dependent kinases regulatory subunit 2 [Source:RefSeq peptide;Acc:NP_001254472] |
| Percent Identity: | 78.48 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFR |
| M.HKQIYY.DKY.DE..EYRHVMLP....K.VPKTHLMSE.EWR.LGVQQS.GWVHYMI.EPEPHILLFR | |
| Retrocopy | MSHKQIYYLDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIQEPEPHILLFR |
| Parental | RPLPKDQQK |
| RPLPK...K | |
| Retrocopy | RPLPKKPKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .45 RPM | 0 .34 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .24 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .13 RPM | 0 .71 RPM |
| SRP007412_heart | 0 .06 RPM | 0 .24 RPM |
| SRP007412_kidney | 0 .35 RPM | 1 .88 RPM |
| SRP007412_liver | 0 .00 RPM | 3 .05 RPM |
| SRP007412_testis | 0 .00 RPM | 71 .20 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000002194 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000007792 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000001260 | 10 retrocopies | |
| Felis catus | ENSFCAG00000022286 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000012534 | 1 retrocopy |
retro_mmul_269 ,
|
| Mus musculus | ENSMUSG00000062248 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000008729 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000028843 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000025843 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000011011 | 3 retrocopies | |
| Rattus norvegicus | ENSRNOG00000014130 | 5 retrocopies | |
| Sus scrofa | ENSSSCG00000021161 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000000048 | 7 retrocopies |