RetrogeneDB ID: | retro_itri_1306 | ||
Retrocopy location | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
| Coordinates: | JH393434.1:4108591..4108817(-) | ||
| Located in intron of: | ENSSTOG00000013888 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CKS2 | ||
| Ensembl ID: | ENSSTOG00000000048 | ||
| Aliases: | None | ||
| Description: | CDC28 protein kinase regulatory subunit 2 [Source:HGNC Symbol;Acc:2000] |
| Percent Identity: | 74.03 % |
| Parental protein coverage: | 96.2 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 1 |
| Parental | HKQIYYSDKYFDEHYEYRHVML-PRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRR |
| HK.IY.S.KYFD.HY.Y.HVML.P....K.VPKTHL.SEEEWRRLGVQQSLGW.HYMI.EPEPHI.LFR. | |
| Retrocopy | HK*IYCSNKYFDDHYKYQHVML>PQNFPK-VPKTHLTSEEEWRRLGVQQSLGWAHYMIREPEPHIFLFR* |
| Parental | PLPKEQQ |
| PL..E.Q | |
| Retrocopy | PLLEE*Q |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000007792 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000009427 | 8 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000004384 | 7 retrocopies | |
| Felis catus | ENSFCAG00000022286 | 1 retrocopy | |
| Homo sapiens | ENSG00000123975 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000012534 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000062248 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000008729 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000028843 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000007583 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000025843 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000021093 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000011011 | 3 retrocopies | |
| Rattus norvegicus | ENSRNOG00000014130 | 5 retrocopies | |
| Sorex araneus | ENSSARG00000002443 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000021161 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000000048 | 7 retrocopies |
retro_itri_1058, retro_itri_1306 , retro_itri_1429, retro_itri_1632, retro_itri_269, retro_itri_585, retro_itri_774,
|