RetrogeneDB ID: | retro_rnor_2742 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 9:79604015..79604238(-) | ||
| Located in intron of: | ENSRNOG00000016472 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Cks2 | ||
| Ensembl ID: | ENSRNOG00000014130 | ||
| Aliases: | Cks2, RGD1562047 | ||
| Description: | cyclin-dependent kinases regulatory subunit 2 [Source:RefSeq peptide;Acc:NP_001119555] |
| Percent Identity: | 72.73 % |
| Parental protein coverage: | 94.94 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTH-LMSEEEWRRLGVQQS-LGWVHYMIHEPEPHILL |
| MAHKQIYY..KY.D.HY...HV.LPR..SKQVPKTH..M.EEEWRRL.VQQS.LG.VH..IHEPEP..LL | |
| Retrocopy | MAHKQIYYTNKYLDKHYKCCHVTLPRAFSKQVPKTH<SMPEEEWRRLSVQQS<LGRVHDRIHEPEPRSLL |
| Parental | FRRPLPK |
| FR.PLPK | |
| Retrocopy | FR*PLPK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 1 .01 RPM |
| SRP017611_kidney | 0 .00 RPM | 2 .37 RPM |
| SRP017611_liver | 0 .00 RPM | 2 .69 RPM |