RetrogeneDB ID: | retro_sscr_458 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 15:67544196..67544469(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CKS2 | ||
| Ensembl ID: | ENSSSCG00000021161 | ||
| Aliases: | None | ||
| Description: | CDC28 protein kinase regulatory subunit 2 [Source:HGNC Symbol;Acc:2000] |
| Percent Identity: | 82.42 % |
| Parental protein coverage: | 96.81 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | PSLRFSAGYPPSCRMAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVH |
| PSL..S..YPP.CRMA.KQI...DKYF.EHYEY..VMLPR.LSKQVPKT.LMSEEEWRRLGVQQS.G.VH | |
| Retrocopy | PSLPSSTAYPPACRMAQKQIC*LDKYFNEHYEYWRVMLPRDLSKQVPKTYLMSEEEWRRLGVQQSVG*VH |
| Parental | YMIHEPEPHILLFRRPLPKDQ |
| YMIHEPEPHILLFRRPLPKDQ | |
| Retrocopy | YMIHEPEPHILLFRRPLPKDQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 9 .95 RPM |
| SRP014902_testis | 0 .00 RPM | 17 .96 RPM |
| SRP018288_heart | 0 .00 RPM | 5 .58 RPM |
| SRP018288_kidney | 0 .00 RPM | 18 .91 RPM |
| SRP018288_liver | 0 .00 RPM | 15 .51 RPM |
| SRP018288_lung | 0 .00 RPM | 6 .31 RPM |
| SRP018856_adipose | 0 .00 RPM | 3 .59 RPM |
| SRP035408_brain | 0 .00 RPM | 3 .49 RPM |
| SRP035408_liver | 0 .00 RPM | 22 .87 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000002194 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000007792 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000001260 | 10 retrocopies | |
| Felis catus | ENSFCAG00000022286 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000012534 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000062248 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000008729 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000028843 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000025843 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000011011 | 3 retrocopies | |
| Rattus norvegicus | ENSRNOG00000014130 | 5 retrocopies | |
| Sus scrofa | ENSSSCG00000021161 | 2 retrocopies |
retro_sscr_458 , retro_sscr_675,
|
| Sus scrofa | ENSSSCG00000029737 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000000048 | 7 retrocopies |