RetrogeneDB ID: | retro_ogar_798 | ||
Retrocopylocation | Organism: | Bushbaby (Otolemur garnettii) | |
Coordinates: | GL873528.1:351706..351943(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CKS2 | ||
Ensembl ID: | ENSOGAG00000028843 | ||
Aliases: | None | ||
Description: | CDC28 protein kinase regulatory subunit 2 [Source:HGNC Symbol;Acc:2000] |
Percent Identity: | 82.28 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFR |
MAHKQIYYS.KYF..HYEYRHVM.PRE.SKQ.PKT.LMSEEE.RRL.VQQ.LGWVHYMIHE.E.HI.LFR | |
Retrocopy | MAHKQIYYSYKYFNKHYEYRHVMSPREPSKQAPKTYLMSEEERRRLSVQQNLGWVHYMIHELELHIILFR |
Parental | RPLPKDQQK |
.PLPKDQQK | |
Retrocopy | LPLPKDQQK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000002194 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000007792 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000001260 | 10 retrocopies | |
Felis catus | ENSFCAG00000022286 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000012534 | 1 retrocopy | |
Mus musculus | ENSMUSG00000062248 | 4 retrocopies | |
Nomascus leucogenys | ENSNLEG00000008729 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000006384 | 10 retrocopies | |
Otolemur garnettii | ENSOGAG00000028843 | 1 retrocopy |
retro_ogar_798 ,
|
Pongo abelii | ENSPPYG00000025843 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000011011 | 3 retrocopies | |
Rattus norvegicus | ENSRNOG00000014130 | 5 retrocopies | |
Sus scrofa | ENSSSCG00000021161 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000000048 | 7 retrocopies |