RetrogeneDB ID: | retro_nleu_530 | ||
Retrocopy location | Organism: | Gibbon (Nomascus leucogenys) | |
| Coordinates: | GL397266.1:46769652..46769896(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL31 | ||
| Ensembl ID: | ENSNLEG00000014444 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 51.22 % |
| Parental protein coverage: | 62.31 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | KKGRSAINEVVTREYTINIHKRIHGVGFKKRAP-RALKEIRKFAMKEMGTPDVRIDTRLNKAVWAKGIRN |
| ..G..AI.EVVTR..T...HK.I...GFKK.AP..ALKE..KF..KE.GTP...I.T.L.KA..AKG.RN | |
| Retrocopy | QEGPPAITEVVTRD*TVDVHKLICREGFKKQAP>GALKEGQKFVLKERGTPIMHIHTKLSKAFPAKGMRN |
| Parental | VPYRIRVRLSRK |
| V........S.K | |
| Retrocopy | VHAMCGSEMSQK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |