RetrogeneDB ID: | retro_ogar_2370 | ||
Retrocopy location | Organism: | Bushbaby (Otolemur garnettii) | |
| Coordinates: | GL873615.1:7716865..7717114(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | UBA52 | ||
| Ensembl ID: | ENSOGAG00000028000 | ||
| Aliases: | None | ||
| Description: | ubiquitin A-52 residue ribosomal protein fusion product 1 [Source:HGNC Symbol;Acc:12458] |
| Percent Identity: | 93.98 % |
| Parental protein coverage: | 64.84 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | EVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLRQL |
| EVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK.STLHLVLR.RGGIIEPSL.QL | |
| Retrocopy | EVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK*STLHLVLRVRGGIIEPSLCQL |
| Parental | AQKYNCDKMICRK |
| AQKYNCDKMIC.. | |
| Retrocopy | AQKYNCDKMICHR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000014723 | 8 retrocopies | |
| Latimeria chalumnae | ENSLACG00000008132 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000017583 | 5 retrocopies | |
| Myotis lucifugus | ENSMLUG00000029594 | 5 retrocopies | |
| Macaca mulatta | ENSMMUG00000016085 | 7 retrocopies | |
| Monodelphis domestica | ENSMODG00000003499 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000015527 | 8 retrocopies | |
| Mus musculus | ENSMUSG00000090137 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000028000 | 10 retrocopies |
retro_ogar_1345, retro_ogar_1419, retro_ogar_1583, retro_ogar_1604, retro_ogar_1792, retro_ogar_2026, retro_ogar_2370 , retro_ogar_2485, retro_ogar_2544, retro_ogar_3337,
|
| Pongo abelii | ENSPPYG00000009746 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000013907 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000004678 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000021461 | 1 retrocopy | |
| Xiphophorus maculatus | ENSXMAG00000003911 | 1 retrocopy |