RetrogeneDB ID: | retro_ptro_2554 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 7:97968858..97969125(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | AP1S1 | ||
Ensembl ID: | ENSPTRG00000019520 | ||
Aliases: | None | ||
Description: | Adaptor-related protein complex 1, sigma 1 subunit [Source:UniProtKB/TrEMBL;Acc:K7B188] |
Percent Identity: | 52.13 % |
Parental protein coverage: | 59.87 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | SLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGDVQDTSKKSVLK |
....CCA...Q.NEL..LE.IH.Y.ELL.KYFGSVCELD..FNFE..YFILDE....G.......K.... | |
Retrocopy | NVQICCATVNQGNELTALETIHHYMELL-KYFGSVCELDVVFNFEEVYFILDELFLEGKLGNLQEKAI-- |
Parental | AIEQADLLQEEDESPRSVLEEMGL |
...QADL.QEE...P..V..E.GL | |
Retrocopy | --AQADLPQEEA*TPHRVVQEIGL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 107 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 29 .79 RPM |
SRP007412_heart | 0 .00 RPM | 4 .43 RPM |
SRP007412_kidney | 0 .00 RPM | 87 .61 RPM |
SRP007412_liver | 0 .00 RPM | 45 .34 RPM |
SRP007412_testis | 0 .00 RPM | 6 .43 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_3765 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000002673 | 1 retrocopy | |
Felis catus | ENSFCAG00000029169 | 1 retrocopy | |
Homo sapiens | ENSG00000106367 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000016245 | 3 retrocopies | |
Microcebus murinus | ENSMICG00000005406 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000009898 | 2 retrocopies | |
Mustela putorius furo | ENSMPUG00000015867 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000006239 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000012979 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000019520 | 3 retrocopies |
retro_ptro_1234, retro_ptro_24, retro_ptro_2554 ,
|