RetrogeneDB ID: | retro_ptro_2368 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 6:89699367..89699684(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | AP4S1 | ||
Ensembl ID: | ENSPTRG00000006239 | ||
Aliases: | None | ||
Description: | adaptor-related protein complex 4, sigma 1 subunit [Source:HGNC Symbol;Acc:575] |
Percent Identity: | 90.65 % |
Parental protein coverage: | 66.04 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | MIKFFLMVNKQGQTRLSKYYEHVDINKRTLLETEVIKSCLS-RSNEQCSFIE-YKDFKLIYRQYAALFIV |
MIKFFLMVNKQGQTRL.KYYEHVDINKRTLLETEVIKSCLS.RSNEQCSFIE.YKDFKLIYRQYA.LF.V | |
Retrocopy | MIKFFLMVNKQGQTRLFKYYEHVDINKRTLLETEVIKSCLS>RSNEQCSFIE>YKDFKLIYRQYASLFVV |
Parental | VGVNDTENEMAIYEFIHNFVEVLDEYFSRVSELDVSF |
VGVNDTEN..AIYEFIHNFVEVLDEYFS.VSELD..F | |
Retrocopy | VGVNDTENKVAIYEFIHNFVEVLDEYFS*VSELDIMF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 4 .77 RPM |
SRP007412_cerebellum | 0 .11 RPM | 4 .30 RPM |
SRP007412_heart | 0 .06 RPM | 1 .57 RPM |
SRP007412_kidney | 0 .03 RPM | 2 .46 RPM |
SRP007412_liver | 0 .00 RPM | 0 .59 RPM |
SRP007412_testis | 1 .16 RPM | 13 .07 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_3496 |
Gorilla gorilla | retro_ggor_2363 |
Pongo abelii | retro_pabe_2889 |
Macaca mulatta | retro_mmul_17 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000013301 | 4 retrocopies | |
Dipodomys ordii | ENSDORG00000009468 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000013009 | 1 retrocopy | |
Homo sapiens | ENSG00000100478 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000003198 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000017579 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000015901 | 1 retrocopy | |
Ornithorhynchus anatinus | ENSOANG00000014031 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000005723 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000006239 | 1 retrocopy |
retro_ptro_2368 ,
|
Pan troglodytes | ENSPTRG00000012979 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000019520 | 3 retrocopies | |
Pteropus vampyrus | ENSPVAG00000017161 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000010759 | 1 retrocopy |