RetrogeneDB ID: | retro_ptro_332 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 1:112419528..112419918(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PFN1 | ||
Ensembl ID: | ENSPTRG00000008616 | ||
Aliases: | None | ||
Description: | profilin 1 [Source:HGNC Symbol;Acc:8881] |
Percent Identity: | 73.85 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | LMADRTCQDAALLGYKDSPSVWAGVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQ |
L.AD.TC.D.A..G.KD.PS.W..VPGKTF.NITPAEVGVLVGKD.SSF..NGLTLGGQK..V..DSLLQ | |
Retrocopy | LVADGTC*DTAIVGNKDPPSIWVAVPGKTFLNITPAEVGVLVGKDWSSFVMNGLTLGGQKYTVVLDSLLQ |
Parental | DGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY |
DGE...DLR.KS.GGAPTFNV.VT.T.K.L.LLMGKEG.HG..INK.CYEMASHL.RSQY | |
Retrocopy | DGELTTDLRMKSIGGAPTFNVIVTMTAKMLGLLMGKEGIHGNFINK*CYEMASHLQRSQY |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .13 RPM | 85 .21 RPM |
SRP007412_cerebellum | 0 .25 RPM | 113 .21 RPM |
SRP007412_heart | 0 .09 RPM | 105 .01 RPM |
SRP007412_kidney | 0 .08 RPM | 290 .99 RPM |
SRP007412_liver | 0 .07 RPM | 606 .30 RPM |
SRP007412_testis | 0 .32 RPM | 52 .16 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000006193 | 2 retrocopies | |
Bos taurus | ENSBTAG00000004915 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000011719 | 2 retrocopies | |
Cavia porcellus | ENSCPOG00000013136 | 1 retrocopy | |
Equus caballus | ENSECAG00000021116 | 3 retrocopies | |
Homo sapiens | ENSG00000108518 | 10 retrocopies | |
Gorilla gorilla | ENSGGOG00000022394 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000002772 | 5 retrocopies | |
Mus musculus | ENSMUSG00000018293 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000017446 | 6 retrocopies | |
Otolemur garnettii | ENSOGAG00000031395 | 3 retrocopies | |
Procavia capensis | ENSPCAG00000000291 | 1 retrocopy | |
Pelodiscus sinensis | ENSPSIG00000004124 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000008616 | 5 retrocopies | |
Rattus norvegicus | ENSRNOG00000003975 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000017905 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000028950 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000001299 | 1 retrocopy | |
Vicugna pacos | ENSVPAG00000005327 | 3 retrocopies |