RetrogeneDB ID: | retro_mmul_732 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 1099214761489:14..420(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PFN1 | ||
Ensembl ID: | ENSMMUG00000002772 | ||
Aliases: | PFN1, profilin-1 | ||
Description: | Profilin [Source:UniProtKB/TrEMBL;Acc:F7H2A5] |
Percent Identity: | 68.84 % |
Parental protein coverage: | 97.14 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 2 |
Parental | NAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTL-GGQKCSV |
.A.I..L.AD.TC.DAAIV..KDSPS.WA..PGKT..NIT.AE.GVLVGKDRSSF.VNGLTL.GG.KC.V | |
Retrocopy | DASIHSLLADRTC*DAAIVRNKDSPSIWATIPGKTLMNITSAELGVLVGKDRSSFFVNGLTL<GG*KCTV |
Parental | IRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKE-GVHGGLINKKCYEMASHLRRSQY |
..DSLLQDGE...DL.TKS..GA..FNVT.T.T.KTL.LLMGKE..VHG...N.KCYEM.S.L.RSQY | |
Retrocopy | VPDSLLQDGELTVDLQTKSIAGASIFNVTRTMTAKTLGLLMGKE<SVHGSFTNNKCYEMSSLLQRSQY |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .11 RPM | 35 .07 RPM |
SRP007412_brain_prefrontal_cortex | 0 .08 RPM | 67 .43 RPM |
SRP007412_cerebellum | 0 .06 RPM | 29 .12 RPM |
SRP007412_heart | 0 .00 RPM | 90 .62 RPM |
SRP007412_kidney | 0 .00 RPM | 116 .31 RPM |
SRP007412_liver | 0 .00 RPM | 304 .16 RPM |
SRP007412_testis | 0 .00 RPM | 35 .43 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000006193 | 2 retrocopies | |
Bos taurus | ENSBTAG00000004915 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000011719 | 2 retrocopies | |
Cavia porcellus | ENSCPOG00000013136 | 1 retrocopy | |
Equus caballus | ENSECAG00000021116 | 3 retrocopies | |
Homo sapiens | ENSG00000108518 | 10 retrocopies | |
Gorilla gorilla | ENSGGOG00000022394 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000002772 | 5 retrocopies | |
Mus musculus | ENSMUSG00000018293 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000017446 | 6 retrocopies | |
Otolemur garnettii | ENSOGAG00000031395 | 3 retrocopies | |
Procavia capensis | ENSPCAG00000000291 | 1 retrocopy | |
Pelodiscus sinensis | ENSPSIG00000004124 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000008616 | 5 retrocopies | |
Rattus norvegicus | ENSRNOG00000003975 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000017905 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000028950 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000001299 | 1 retrocopy | |
Vicugna pacos | ENSVPAG00000005327 | 3 retrocopies |