RetrogeneDB ID: | retro_ptro_565 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 11:92993362..92993598(+) | ||
Located in intron of: | ENSPTRG00000004192 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPS16 | ||
Ensembl ID: | ENSPTRG00000010970 | ||
Aliases: | None | ||
Description: | ribosomal protein S16 [Source:HGNC Symbol;Acc:10396] |
Percent Identity: | 71.25 % |
Parental protein coverage: | 54.11 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | LLLGKERFAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVADPR |
LLLGKE.FAGVDI.V.VK..GHVAQI.AI.Q..SK.LVAY.QKYV.EA.KK.IKDILIQYD..LL.ADP. | |
Retrocopy | LLLGKEWFAGVDICVYVKSSGHVAQICAIQQYVSKSLVAYCQKYVNEAFKKQIKDILIQYDWILLIADPL |
Parental | R-CESKKFGG |
..C..KK.GG | |
Retrocopy | A<CKFKKLGG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 216 .57 RPM |
SRP007412_cerebellum | 0 .04 RPM | 203 .40 RPM |
SRP007412_heart | 0 .00 RPM | 172 .46 RPM |
SRP007412_kidney | 0 .00 RPM | 372 .58 RPM |
SRP007412_liver | 0 .07 RPM | 365 .87 RPM |
SRP007412_testis | 0 .21 RPM | 58 .91 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_813 |
Gorilla gorilla | retro_ggor_667 |
Macaca mulatta | retro_mmul_1080 |
Callithrix jacchus | retro_cjac_905 |