RetrogeneDB ID: | retro_ggor_667 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 11:92550724..92550955(+) | ||
Located in intron of: | ENSGGOG00000004922 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ENSG00000105193 | ||
Ensembl ID: | ENSGGOG00000014414 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 70.13 % |
Parental protein coverage: | 51.68 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | LLLGKERFAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVADPR |
LLLGKE.FAGVDI.V.VK..GHV.QI.AI.Q..SK.LVAY.QKYV.EASKK.IKDILIQYD..LL.ADP. | |
Retrocopy | LLLGKEWFAGVDICVYVKSSGHVPQIWAIQQYVSKSLVAYCQKYVNEASKKQIKDILIQYDWILLIADPL |
Parental | RCESKKF |
...SK.. | |
Retrocopy | AANSKSW |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 130 .91 RPM |
SRP007412_cerebellum | 0 .04 RPM | 163 .15 RPM |
SRP007412_heart | 0 .03 RPM | 136 .65 RPM |
SRP007412_kidney | 0 .00 RPM | 339 .46 RPM |
SRP007412_liver | 0 .00 RPM | 456 .55 RPM |
SRP007412_testis | 0 .00 RPM | 197 .15 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_813 |
Pan troglodytes | retro_ptro_565 |
Macaca mulatta | retro_mmul_1080 |
Callithrix jacchus | retro_cjac_905 |