RetrogeneDB ID: | retro_cjac_905 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 11:42515424..42515649(-) | ||
Located in intron of: | ENSCJAG00000004213 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPS16 | ||
Ensembl ID: | ENSCJAG00000014170 | ||
Aliases: | None | ||
Description: | ribosomal protein S16 [Source:HGNC Symbol;Acc:10396] |
Percent Identity: | 73.33 % |
Parental protein coverage: | 51.37 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | LLLGKERFAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVADPR |
LLLGKE.FAGVDI.V.VKGGGHVAQI..I.Q..SK.LVAYYQKY..EASKK.IKDILIQ.D..LL.ADP. | |
Retrocopy | LLLGKEWFAGVDISVHVKGGGHVAQICVIQQYVSKSLVAYYQKYMNEASKKQIKDILIQCDWILLAADPV |
Parental | RCESK |
...SK | |
Retrocopy | VANSK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .42 RPM | 105 .26 RPM |
SRP051959_heart | 0 .58 RPM | 87 .65 RPM |
SRP051959_kidney | 1 .04 RPM | 87 .48 RPM |
SRP051959_liver | 0 .41 RPM | 106 .61 RPM |
SRP051959_lung | 1 .66 RPM | 109 .63 RPM |
SRP051959_lymph_node | 3 .10 RPM | 183 .03 RPM |
SRP051959_skeletal_muscle | 0 .02 RPM | 109 .23 RPM |
SRP051959_spleen | 3 .59 RPM | 149 .94 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_813 |
Pan troglodytes | retro_ptro_565 |
Gorilla gorilla | retro_ggor_667 |
Macaca mulatta | retro_mmul_1080 |