RetrogeneDB ID: | retro_cjac_885 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 11:120496071..120496316(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS16 | ||
| Ensembl ID: | ENSCJAG00000014170 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S16 [Source:HGNC Symbol;Acc:10396] |
| Percent Identity: | 65.48 % |
| Parental protein coverage: | 56.85 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | LQYKLLEPVLLLGKERFAGVDIRVRVKGGG-HVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQY |
| .Q.KLLE.VL.LGKE.FA.VD..V.VKG...HVAQI.A..QSISKALVAYY.K..DEASK.....ILI.. | |
| Retrocopy | MQLKLLELVLPLGKEQFADVDTHVCVKGAV<HVAQIFALHQSISKALVAYYWK*MDEASKR-MNGILI*Q |
| Parental | DRTLLVADPRRCES |
| DRTL.VADP..C.S | |
| Retrocopy | DRTLPVADPHCCKS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .07 RPM | 105 .26 RPM |
| SRP051959_heart | 0 .05 RPM | 87 .65 RPM |
| SRP051959_kidney | 0 .04 RPM | 87 .48 RPM |
| SRP051959_liver | 0 .00 RPM | 106 .61 RPM |
| SRP051959_lung | 0 .08 RPM | 109 .63 RPM |
| SRP051959_lymph_node | 0 .05 RPM | 183 .03 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 109 .23 RPM |
| SRP051959_spleen | 0 .06 RPM | 149 .94 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_787 |
| Pan troglodytes | retro_ptro_548 |
| Gorilla gorilla | retro_ggor_652 |