RetrogeneDB ID: | retro_xtro_1 | ||
Retrocopy location | Organism: | Xenopus (Xenopus tropicalis) | |
| Coordinates: | GL172695.1:2686650..2687226(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSXETG00000030340 | |
| Aliases: | None | ||
| Status: | KNOWN_PROTEIN_CODING | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | rac1 | ||
| Ensembl ID: | ENSXETG00000027593 | ||
| Aliases: | None | ||
| Description: | ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1) [Source:Jamboree;Acc:XB-GENE-489008] |
| Percent Identity: | 50.41 % |
| Parental protein coverage: | 63.02 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPL |
| M..IKCV.VGD.AVGKT.LL...T..AFP..Y.PTV..N....V..DG....LGLWDTAG.......RPL | |
| Retrocopy | MNSIKCVLVGDAAVGKTALLVRFTSEAFPDSYRPTVYENTGVDVYMDGVQISLGLWDTAGNDAFRSIRPL |
| Parental | SYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRD |
| S....D..L.CFS.....SF.NVR.KW..EVR.H.P..P...V.T..D.R. | |
| Retrocopy | SLQNADIVLLCFSVANHTSFLNVRNKWIGEVRQHLPRIPVLVVATQTDQRE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 490 .11 RPM |
| SRP007412_heart | 0 .19 RPM | 145 .33 RPM |
| SRP007412_kidney | 0 .19 RPM | 145 .33 RPM |
| SRP007412_liver | 0 .96 RPM | 72 .67 RPM |
| SRP007412_skeletal_muscle | 0 .06 RPM | 63 .99 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000009233 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000015716 | 1 retrocopy | |
| Felis catus | ENSFCAG00000011361 | 2 retrocopies | |
| Homo sapiens | ENSG00000136238 | 6 retrocopies | |
| Gorilla gorilla | ENSGGOG00000026733 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000012844 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000009701 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000021075 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000001847 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000009956 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000018910 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000001068 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000006784 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000007272 | 4 retrocopies | |
| Tarsius syrichta | ENSTSYG00000001618 | 2 retrocopies | |
| Xenopus tropicalis | ENSXETG00000027593 | 1 retrocopy |
retro_xtro_1 ,
|