RetrogeneDB ID: | retro_ptro_3274 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | X:138132575..138133001(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RAC1 | ||
Ensembl ID: | ENSPTRG00000018910 | ||
Aliases: | None | ||
Description: | Pan troglodytes ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1) (RAC1), mRNA. [Source:RefSeq mRNA;Acc:NM_001246381] |
Percent Identity: | 93.66 % |
Parental protein coverage: | 73.96 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | VNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR |
VNLGLW.TAGQEDYDRLRPLSYPQ.DVFLICFSLVSPASFENV.AKWYPEV.HHCPNTPIILVGTKLDLR | |
Retrocopy | VNLGLWNTAGQEDYDRLRPLSYPQADVFLICFSLVSPASFENVLAKWYPEVQHHCPNTPIILVGTKLDLR |
Parental | DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCL |
DDKD.I.KLKEKKLTPITYPQGLAMAKE.GAVKYLEC.ALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCL | |
Retrocopy | DDKDRIQKLKEKKLTPITYPQGLAMAKEMGAVKYLECLALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCL |
Parental | LL |
.L | |
Retrocopy | QL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 185 .02 RPM |
SRP007412_cerebellum | 0 .11 RPM | 247 .07 RPM |
SRP007412_heart | 0 .06 RPM | 136 .81 RPM |
SRP007412_kidney | 0 .03 RPM | 172 .24 RPM |
SRP007412_liver | 0 .00 RPM | 129 .69 RPM |
SRP007412_testis | 0 .00 RPM | 92 .63 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_4910 |
Gorilla gorilla | retro_ggor_217 |
Pongo abelii | retro_pabe_3818 |
Macaca mulatta | retro_mmul_2642 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000009233 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000015716 | 1 retrocopy | |
Felis catus | ENSFCAG00000011361 | 2 retrocopies | |
Homo sapiens | ENSG00000136238 | 6 retrocopies | |
Gorilla gorilla | ENSGGOG00000026733 | 2 retrocopies | |
Loxodonta africana | ENSLAFG00000012844 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000009701 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000021075 | 4 retrocopies | |
Mus musculus | ENSMUSG00000001847 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000009956 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000006424 | 4 retrocopies | |
Pan troglodytes | ENSPTRG00000018910 | 4 retrocopies | |
Rattus norvegicus | ENSRNOG00000001068 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000006784 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000007272 | 4 retrocopies | |
Tarsius syrichta | ENSTSYG00000001618 | 2 retrocopies | |
Xenopus tropicalis | ENSXETG00000027593 | 1 retrocopy |