RetrogeneDB ID: | retro_btau_1476 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
Coordinates: | 6:8879327..8879545(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | BT.49114 | ||
Ensembl ID: | ENSBTAG00000014226 | ||
Aliases: | None | ||
Description: | 60S ribosomal protein L34 [Source:RefSeq peptide;Acc:NP_001193150] |
Percent Identity: | 56.76 % |
Parental protein coverage: | 57.03 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 1 |
Parental | HLEAFRMVQRLTYRRR-LSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVRPKV |
HL.AFR.VQ.L.Y.....SYN..SNK.RL..T..NR.VY..T.K.GKAPK.A...C.G.L.G..AVRP.V | |
Retrocopy | HLKAFRLVQILMYYCK<VSYNIDSNKPRLF*TSANRTVYI*TGKFGKAPKGAYDMCLG*LQGFQAVRPEV |
Parental | LMRL |
L.RL | |
Retrocopy | LVRL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
ERP005899_liver | 0 .00 RPM | 105 .91 RPM |
ERP005899_muscle | 0 .00 RPM | 575 .82 RPM |
SRP017611_brain | 0 .00 RPM | 50 .80 RPM |
SRP017611_kidney | 0 .00 RPM | 134 .37 RPM |
SRP017611_liver | 0 .00 RPM | 76 .57 RPM |
SRP030211_testis | 0 .00 RPM | 71 .69 RPM |