RetrogeneDB ID: | retro_btau_528 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
Coordinates: | 13:48199782..48200010(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | IMMP1L | ||
Ensembl ID: | ENSBTAG00000000475 | ||
Aliases: | None | ||
Description: | mitochondrial inner membrane protease subunit 1 [Source:RefSeq peptide;Acc:NP_001073095] |
Percent Identity: | 75. % |
Parental protein coverage: | 67.26 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MLRGVLGKTFRLVGYTIQYGCIAHCAFEYVGGVLVCSGPSMEPTIQNSDIVFAENLSRHFYGIQRGDIVV |
ML..VLGK.F.LV.YTI.YGCIAH.AFEYVG.V..C..PSMEPTIQNSD.VFAE.L.RHFYGIQR.DI.. | |
Retrocopy | MLCVVLGKMFWLVSYTI*YGCIAHGAFEYVGSVVMCFEPSMEPTIQNSDTVFAESLNRHFYGIQRDDIMI |
Parental | AKSPSD |
.KSPSD | |
Retrocopy | TKSPSD |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
ERP005899_liver | 0 .00 RPM | 5 .91 RPM |
ERP005899_muscle | 0 .00 RPM | 4 .80 RPM |
SRP017611_brain | 0 .00 RPM | 3 .47 RPM |
SRP017611_kidney | 0 .00 RPM | 8 .30 RPM |
SRP017611_liver | 0 .00 RPM | 2 .42 RPM |
SRP030211_testis | 0 .00 RPM | 6 .08 RPM |