RetrogeneDB ID: | retro_btau_577 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
Coordinates: | 15:39591872..39592245(+) | ||
Located in intron of: | ENSBTAG00000009061 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPS24 | ||
Ensembl ID: | ENSBTAG00000013264 | ||
Aliases: | None | ||
Description: | 40S ribosomal protein S24 [Source:UniProtKB/Swiss-Prot;Acc:Q56JU9] |
Percent Identity: | 70.45 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 2 |
Parental | MNDTVTIRTRKFMTNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTHFGGGKTT |
MN.TV...TRKFMTN.....KQ.VI..LHPGKA.V.K.EI..KLAKMYKTTPDVI..FGFR.HFG.GKTT | |
Retrocopy | MNETVILQTRKFMTNQ----KQIVINILHPGKAKVAKIEI*VKLAKMYKTTPDVILEFGFRIHFGSGKTT |
Parental | GFGMIYDSLDYAKKNEPKHRLARHGLYEKKK-TSRKQRKER-KNRMKKVRGTAKANVGAGKK |
.FG..Y.SLDY.KKNE.KH..AR.GLY.KKK.TSRKQ.KER.KNRM..V..TAKAN.GAGKK | |
Retrocopy | SFGRFYYSLDYRKKNELKH*HARYGLY-KKK<TSRKQQKER<KNRMQEVKRTAKANLGAGKK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
ERP005899_liver | 0 .00 RPM | 437 .33 RPM |
ERP005899_muscle | 0 .00 RPM | 1212 .35 RPM |
SRP017611_brain | 0 .00 RPM | 187 .15 RPM |
SRP017611_kidney | 0 .00 RPM | 336 .31 RPM |
SRP017611_liver | 0 .00 RPM | 240 .49 RPM |
SRP030211_testis | 0 .05 RPM | 173 .01 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000013264 | 9 retrocopies |
retro_btau_1137, retro_btau_1311, retro_btau_1562, retro_btau_285, retro_btau_467, retro_btau_577 , retro_btau_586, retro_btau_788, retro_btau_980,
|
Felis catus | ENSFCAG00000000849 | 3 retrocopies | |
Homo sapiens | ENSG00000138326 | 3 retrocopies | |
Gadus morhua | ENSGMOG00000012595 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000027878 | 10 retrocopies | |
Myotis lucifugus | ENSMLUG00000024102 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000003778 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000012472 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000011005 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000002666 | 10 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000013000 | 4 retrocopies |