RetrogeneDB ID: | retro_cfam_1196 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 26:21902021..21902235(+) | ||
| Located in intron of: | ENSCAFG00000011849 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS12 | ||
| Ensembl ID: | ENSCAFG00000000190 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S12 [Source:HGNC Symbol;Acc:10385] |
| Percent Identity: | 76.71 % |
| Parental protein coverage: | 54.55 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | YVKLVEALCAEHQINLIKVDDNKKLGEWVGLC-KIDREGKPRKVVGCSCVVVKDYGKESQAKDVIEEYFK |
| YV..V...CAEHQINLIKVDDNKKLGEWVGLC.K......P..V.GCSCVVVKDY.KESQAKDVIEEYFK | |
| Retrocopy | YVYQVGGGCAEHQINLIKVDDNKKLGEWVGLC>KLTERENP-VVFGCSCVVVKDYSKESQAKDVIEEYFK |
| Parental | CKK |
| .KK | |
| Retrocopy | YKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 169 .68 RPM |
| SRP017611_brain | 0 .00 RPM | 48 .83 RPM |
| SRP017611_kidney | 0 .00 RPM | 732 .35 RPM |
| SRP017611_liver | 0 .00 RPM | 141 .84 RPM |