RetrogeneDB ID: | retro_pabe_2694 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 5:144117964..144118194(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS12 | ||
| Ensembl ID: | ENSPPYG00000017020 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S12 [Source:HGNC Symbol;Acc:10385] |
| Percent Identity: | 57.69 % |
| Parental protein coverage: | 56.82 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | DEPMYVKLVEALCAEHQINLIKVD--DNKKLGEWVGLCKIDREGKPRKVVGC-SCVVVKDYGKESQAKDV |
| DEP..VK..EALCAE.Q.N..K......K..G...G.CKIDREG.P...V.C..CV.VK..GKESQ..DV | |
| Retrocopy | DEPTSVKSGEALCAELQVNRLKGG**QKKPRGQVGGPCKIDREGRPCTAVSC<CCVIVKNCGKESQVEDV |
| Parental | IEEYFKCK |
| IEEYFKC. | |
| Retrocopy | IEEYFKCR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 49 .37 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 77 .82 RPM |
| SRP007412_heart | 0 .00 RPM | 95 .16 RPM |
| SRP007412_kidney | 0 .00 RPM | 162 .85 RPM |
| SRP007412_liver | 0 .00 RPM | 172 .65 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3249 |
| Pan troglodytes | retro_ptro_2197 |
| Callithrix jacchus | retro_cjac_1778 |