RetrogeneDB ID: | retro_pabe_704 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 11:68056384..68056590(+) | ||
| Located in intron of: | ENSPPYG00000003653 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS12 | ||
| Ensembl ID: | ENSPPYG00000017020 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S12 [Source:HGNC Symbol;Acc:10385] |
| Percent Identity: | 53.52 % |
| Parental protein coverage: | 53.03 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | KLVEALCAEHQINLIKVDDNKK-LGEWVGLCKIDREGKPRKVVGCSCVVVKDYGKESQAKDVIEEYFKCK |
| .L.EALC.EH...L...DDNKK...E.VGL.....E...........VV.KDYGKESQ.KDVI.E.FKCK | |
| Retrocopy | QLGEALCVEH*VYLFRADDNKK<TQERVGLSD*QSENACQAGLQLCVVV-KDYGKESQGKDVIKENFKCK |
| Parental | K |
| K | |
| Retrocopy | K |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .11 RPM | 49 .37 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 77 .82 RPM |
| SRP007412_heart | 0 .00 RPM | 95 .16 RPM |
| SRP007412_kidney | 0 .03 RPM | 162 .85 RPM |
| SRP007412_liver | 0 .03 RPM | 172 .65 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Equus caballus | retro_ecab_959 |