RetrogeneDB ID: | retro_chof_1000 | ||
Retrocopylocation | Organism: | Sloth (Choloepus hoffmanni) | |
Coordinates: | scaffold_18233:4289..4698(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ATP1B3 | ||
Ensembl ID: | ENSCHOG00000007515 | ||
Aliases: | None | ||
Description: | ATPase, Na+/K+ transporting, beta 3 polypeptide [Source:HGNC Symbol;Acc:806] |
Percent Identity: | 52.48 % |
Parental protein coverage: | 56.43 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 4 |
Parental | CQFPVHLLEECSGMRDPDFGYSKGKPCVLVKMNRIIGLKPEGEPRIMCVPKDGN-TAVLSTYPHNGIVDL |
CQFP..LL..CS.M....F.Y.KGKPCVL..M..IIGLKP...P...C..K..N..A.L.TY.H.GI..L | |
Retrocopy | CQFPPTLLKACSAMDHLHFHYFKGKPCVLYRMTGIIGLKP*EDPTAVCILKENN<QAALITYLHKGITGL |
Parental | KYFPYYG-KKLHVGYLQP-VVAVQPVFSSNS-TKKETTVECKIDGSPNL-KSQDDRDKFLGRVVFKITVN |
.YF.Y...KKLH.G...P....VQ..F..N..T.KE.T.EC..DG.PNL.K.QD...KFLG...FK.TVN | |
Retrocopy | NYFAYFT<KKLHMGHPYP>TLLVQVIFDQNADTRKEGTMECRTDGQPNL<KNQDNGEKFLG*IEFKMTVN |
Parental | A |
A | |
Retrocopy | A |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000014140 | 5 retrocopies | |
Choloepus hoffmanni | ENSCHOG00000007515 | 4 retrocopies | |
Callithrix jacchus | ENSCJAG00000001981 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000003739 | 4 retrocopies | |
Equus caballus | ENSECAG00000019885 | 2 retrocopies | |
Homo sapiens | ENSG00000069849 | 2 retrocopies | |
Loxodonta africana | ENSLAFG00000010553 | 1 retrocopy | |
Mus musculus | ENSMUSG00000032412 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000004663 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000008662 | 1 retrocopy | |
Procavia capensis | ENSPCAG00000013927 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000014169 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000015476 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000011501 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000011676 | 3 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000013235 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000001004 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000000222 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000012038 | 1 retrocopy |