RetrogeneDB ID: | retro_chof_1000 | ||
Retrocopy location | Organism: | Sloth (Choloepus hoffmanni) | |
| Coordinates: | scaffold_18233:4289..4698(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ATP1B3 | ||
| Ensembl ID: | ENSCHOG00000007515 | ||
| Aliases: | None | ||
| Description: | ATPase, Na+/K+ transporting, beta 3 polypeptide [Source:HGNC Symbol;Acc:806] |
| Percent Identity: | 52.48 % |
| Parental protein coverage: | 56.43 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 4 |
| Parental | CQFPVHLLEECSGMRDPDFGYSKGKPCVLVKMNRIIGLKPEGEPRIMCVPKDGN-TAVLSTYPHNGIVDL |
| CQFP..LL..CS.M....F.Y.KGKPCVL..M..IIGLKP...P...C..K..N..A.L.TY.H.GI..L | |
| Retrocopy | CQFPPTLLKACSAMDHLHFHYFKGKPCVLYRMTGIIGLKP*EDPTAVCILKENN<QAALITYLHKGITGL |
| Parental | KYFPYYG-KKLHVGYLQP-VVAVQPVFSSNS-TKKETTVECKIDGSPNL-KSQDDRDKFLGRVVFKITVN |
| .YF.Y...KKLH.G...P....VQ..F..N..T.KE.T.EC..DG.PNL.K.QD...KFLG...FK.TVN | |
| Retrocopy | NYFAYFT<KKLHMGHPYP>TLLVQVIFDQNADTRKEGTMECRTDGQPNL<KNQDNGEKFLG*IEFKMTVN |
| Parental | A |
| A | |
| Retrocopy | A |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000014140 | 5 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000007515 | 4 retrocopies | |
| Callithrix jacchus | ENSCJAG00000001981 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000003739 | 4 retrocopies | |
| Equus caballus | ENSECAG00000019885 | 2 retrocopies | |
| Homo sapiens | ENSG00000069849 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000010553 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000032412 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000004663 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000008662 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000013927 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000014169 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000015476 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000011501 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000011676 | 3 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000013235 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000001004 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000000222 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000012038 | 1 retrocopy |