RetrogeneDB ID: | retro_cjac_1125 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 13:11443926..11444118(-) | ||
Located in intron of: | ENSCJAG00000019873 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPLP1 | ||
Ensembl ID: | ENSCJAG00000032919 | ||
Aliases: | None | ||
Description: | ribosomal protein, large, P1 [Source:HGNC Symbol;Acc:10372] |
Percent Identity: | 64.06 % |
Parental protein coverage: | 56.14 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | SVSELACIYSALILHDDEVTVTEDKINALIKAAGVNVEPFWPGLFAKALANVNIGSLICNVGAG |
SVSELAC..SAL.LH..E....EDK.N.L.KAAGVN...FWP.L..KALA.V.IGSL.C..GAG | |
Retrocopy | SVSELACTDSALVLHNSEAIIIEDKVNILTKAAGVNDDGFWPVLSSKALAIVKIGSLLCSGGAG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .02 RPM | 107 .48 RPM |
SRP051959_heart | 0 .14 RPM | 102 .58 RPM |
SRP051959_kidney | 0 .07 RPM | 120 .09 RPM |
SRP051959_liver | 0 .37 RPM | 96 .48 RPM |
SRP051959_lung | 0 .07 RPM | 121 .91 RPM |
SRP051959_lymph_node | 0 .07 RPM | 168 .97 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 176 .65 RPM |
SRP051959_spleen | 0 .02 RPM | 171 .41 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_3939 |
Macaca mulatta | retro_mmul_2282 |