RetrogeneDB ID: | retro_cpor_1203 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_56:10587272..10587584(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CASP3 | ||
| Ensembl ID: | ENSCPOG00000012511 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 64.42 % |
| Parental protein coverage: | 51.49 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | IHGSKSMDSGIFLDNRYKMDYPEMGLCIVINNKNFHKSTGMAPRLGTDVDAASIRETFMNLKYEVRNKND |
| .HGSKS..SGIFLDN...M.Y.EMGLC.VIN.KNFH.STGM.....TDVDAA.IRE...N..YE.RNKND | |
| Retrocopy | LHGSKSVNSGIFLDNGFEMSYSEMGLCTVINKKNFH*STGMTAWSDTDVDAANIREILINFNYELRNKND |
| Parental | LSCEEIMNLMYSVSKEDHSKRSSFVCVILSHGEE |
| L.CE.IM.L.....KEDHSK.SS.VC..LSH..E | |
| Retrocopy | LTCEKIMELISKIPKEDHSKTSSIVCIMLSHRQE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 2 .65 RPM |
| SRP017611_kidney | 0 .00 RPM | 2 .62 RPM |
| SRP017611_liver | 0 .00 RPM | 6 .49 RPM |
| SRP040447_lung | 0 .00 RPM | 4 .11 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 1 .38 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Cavia porcellus | ENSCPOG00000012511 | 2 retrocopies |
retro_cpor_1203 , retro_cpor_1450,
|
| Dasypus novemcinctus | ENSDNOG00000013931 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000004809 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000012053 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000005985 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000010475 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000009178 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000003865 | 2 retrocopies |